AibGenesis™ Mouse Anti-Smt2-1 Antibody (CBMOAB-89431FYB)


Cat: CBMOAB-89431FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-89431FYB Monoclonal Rice (Oryza), Soybean (Glycine max) WB, ELISA MO89431FYB 100 µg
MO-AB-32603H Monoclonal Soybean (Glycine max) WB, ELISA MO32603C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Soybean (Glycine max)
CloneMO89431FYB
SpecificityThis antibody binds to Rice Smt2-1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice Smt2-1 Antibody is a mouse antibody against Smt2-1. It can be used for Smt2-1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names24-methylenesterol C-methyltransferase 2; 24-sterol C-methyltransferase 2; Sterol-C-methyltransferase 2; EC 2.1.1.143; Smt2-1; Os03g0136200 LOC_Os03g04340
UniProt IDO82427
Protein RefseqThe length of the protein is 363 amino acids long.
The sequence is show below: MEAATMAWTAAGVGMALVYWFVWVMGAAEVKGKRAVDLKMGSITNDKVKDKYTQYWSFFRRPKETATTEASAEKVPAFVDTFYNLVTDIYEWGWGQSFHFSPSLPGRSHREATRVHEERVADLLQAKPGHRLLDVGCGVGGPMRAIAAHSGSNVVGITINEYQVNRARAHNRKAGLDSRCEVVCGNFLSMPFSDASFDGAYSIEATCHAPRLQDVYGEVFRVLKPGGLYVSYEWVTTSLYRADNPEHVEAIHGIERGDALPGLRRQDEIASIAKEVGFEVLKELDLALPPALPWWTRLKMGRIAYWRNSLVVRVLTMLRIAPKGVCEVHEMLYETAQHLTRGGETGIFTPMHMVLLRKPVESK.
For Research Use Only | Not For Clinical Use.
Online Inquiry