AibGenesis™ Mouse Anti-SNA2 Antibody (CBMOAB-04057CR)
Cat: CBMOAB-04057CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, C. elegans (Caenorhabditis elegans) |
| Clone | MO04057CR |
| Specificity | This antibody binds to Yeast SNA2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Vacuole; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Present with 20400 molecules/cell in log phase SD medium. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast SNA2 Antibody is a mouse antibody against SNA2. It can be used for SNA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein SNA2; SNA2; YDR525W-A |
| UniProt ID | P56508 |
| Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: MHARDWFLVFIAIFIPPLAVWLKRGFFTKDLLINFLLFLLGFFPGLIHALYVISCHPYEENEARYSHLSSSDDNYGSLA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry