AibGenesis™ Mouse Anti-SNA2 Antibody (CBMOAB-04057CR)


Cat: CBMOAB-04057CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-04057CR Monoclonal Yeast, C. elegans (Caenorhabditis elegans) WB, ELISA MO04057CR 100 µg
Inquiry
CBMOAB-09965HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO09965HB 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, C. elegans (Caenorhabditis elegans)
CloneMO04057CR
SpecificityThis antibody binds to Yeast SNA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationVacuole; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPresent with 20400 molecules/cell in log phase SD medium. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Yeast SNA2 Antibody is a mouse antibody against SNA2. It can be used for SNA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein SNA2; SNA2; YDR525W-A
UniProt IDP56508
Protein RefseqThe length of the protein is 79 amino acids long. The sequence is show below: MHARDWFLVFIAIFIPPLAVWLKRGFFTKDLLINFLLFLLGFFPGLIHALYVISCHPYEENEARYSHLSSSDDNYGSLA.
For Research Use Only | Not For Clinical Use.
Online Inquiry