Mouse Anti-SNCA Antibody (MO-AB-01433L)


Cat: MO-AB-01433L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01433L Monoclonal Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO01433L 100 µg
MO-AB-01627R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01627R 100 µg
MO-AB-04073Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04073Y 100 µg
MO-AB-08238W Monoclonal Cat (Felis catus) WB, ELISA MO08238W 100 µg
MO-AB-10045Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10045Y 100 µg
MO-AB-15465W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15465W 100 µg
MO-AB-17739Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17739Y 100 µg
MO-AB-20652R Monoclonal Cattle (Bos taurus) WB, ELISA MO20652R 100 µg
MO-AB-23751H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23751C 100 µg
MO-AB-29060H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29060C 100 µg
MO-AB-30270R Monoclonal Pig (Sus scrofa) WB, ELISA MO30270R 100 µg
MO-AB-42614W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42614W 100 µg
MO-AB-46625W Monoclonal Horse (Equus caballus) WB, ELISA MO46625W 100 µg
MO-AB-64982W Monoclonal Marmoset WB, ELISA MO64982W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityElephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO01433L
SpecificityThis antibody binds to Elephant SNCA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytosol; Cytoskeleton; Mitochondrion; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAlpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer''s disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.
Product OverviewThis product is a mouse antibody against SNCA. It can be used for SNCA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSynuclein Alpha; Synuclein, Alpha (Non A4 Component Of Amyloid Precursor); Alpha-Synuclein; PARK1; NACP; Parkinson Disease (Autosomal Dominant, Lewy Body) 4; Non A4 Component Of Amyloid Precursor; Non-A4 Component Of Amyloid Precursor
UniProt IDG3T7Z3
Protein RefseqThe length of the protein is 140 amino acids long. The sequence is show below: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQMGKGEEGAPQEGILENVPVDPDNEAYEMPSEEGYQDYEPEA.
For Research Use Only | Not For Clinical Use.
Online Inquiry