AibGenesis™ Mouse Anti-SNCA Antibody (MO-AB-01433L)
Cat: MO-AB-01433L

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-01433L | Monoclonal | Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) | WB, ELISA | MO01433L | 100 µg | ||
| MO-AB-01627R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01627R | 100 µg | ||
| MO-AB-04073Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO04073Y | 100 µg | ||
| MO-AB-08238W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08238W | 100 µg | ||
| MO-AB-10045Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO10045Y | 100 µg | ||
| MO-AB-15465W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15465W | 100 µg | ||
| MO-AB-17739Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17739Y | 100 µg | ||
| MO-AB-20652R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20652R | 100 µg | ||
| MO-AB-23751H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23751C | 100 µg | ||
| MO-AB-29060H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29060C | 100 µg | ||
| MO-AB-30270R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO30270R | 100 µg | ||
| MO-AB-42614W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42614W | 100 µg | ||
| MO-AB-46625W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46625W | 100 µg | ||
| MO-AB-64982W | Monoclonal | Marmoset | WB, ELISA | MO64982W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Medaka (Oryzias latipes), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Sheep (Ovis aries) |
| Clone | MO01433L |
| Specificity | This antibody binds to Elephant SNCA. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane; Cytosol; Cytoskeleton; Mitochondrion; Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | This product is a mouse antibody against SNCA. It can be used for SNCA detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Synuclein Alpha; Synuclein, Alpha (Non A4 Component Of Amyloid Precursor); Alpha-Synuclein; PARK1; NACP; Parkinson Disease (Autosomal Dominant, Lewy Body) 4; Non A4 Component Of Amyloid Precursor; Non-A4 Component Of Amyloid Precursor |
| UniProt ID | G3T7Z3 |
| Protein Refseq | The length of the protein is 140 amino acids long. The sequence is show below: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGEAVVTGVTAVAQKTVEGAGSIAAATGFGKKDQMGKGEEGAPQEGILENVPVDPDNEAYEMPSEEGYQDYEPEA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry