AibGenesis™ Mouse Anti-SNTN Antibody (MO-AB-20684R)


Cat: MO-AB-20684R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20684R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO20684R 100 µg
MO-AB-29089H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29089C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO20684R
SpecificityThis antibody binds to Cattle SNTN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against SNTN. It can be used for SNTN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSentan; Protein S100-A1-like; S100 calcium-binding protein A1-like; SNTN; S100A1L
UniProt IDQ0P561
Protein RefseqThe length of the protein is 147 amino acids long.
The sequence is show below: MCGCVHSTQDQALRLEGEPNPPAAPTSTLAPKNMPKSISISKQLASIKALRKGSDLEKAIATAALVFRNSSDPDGKLRKATAKNLLQTQFKNFAEGQETKARYKDLLSELDEHTENKLDFEDFMVLLLSVTIMSDLLQNIWSVKITQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry