AibGenesis™ Mouse Anti-snx11 Antibody (CBMOAB-06745FYB)


Cat: CBMOAB-06745FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06745FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO06745FYB 100 µg
MO-AB-07901H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07901C 100 µg
MO-AB-17658W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17658W 100 µg
MO-AB-20694R Monoclonal Cattle (Bos taurus) WB, ELISA MO20694R 100 µg
MO-AB-29093H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29093C 100 µg
MO-AB-65039W Monoclonal Marmoset WB, ELISA MO65039W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO06745FYB
SpecificityThis antibody binds to Zebrafish snx11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members. This gene encodes a protein of unknown function. This gene results in two transcript variants differing in the 5' UTR, but encoding the same protein. (From NCBI)
Product OverviewMouse Anti-Zebrafish snx11 Antibody is a mouse antibody against snx11. It can be used for snx11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSi:dkey-220f10.6; snx11; si:dkey-220f10.
UniProt IDQ1ED00
Protein RefseqThe length of the protein is 506 amino acids long.
The sequence is show below: MSKSQEQDEFIAVRVQDPRVQNEGSWNSYVDFKIFLHTNSKAFTAKTSCVRRRYSEFAWLKKKLQKNAGLVPVPELPKKSIFSFINDDFIERRRKGLQGFLDKVLHMTVCLSDSQLHLFLQTQLPVKHIEDCVHGHTPYTVTEAILSYASSNRGWVQEEGGADQELCSTTVSYESVESPVPHLPSLQSPGALSSGPPNELTDASELRLSDTEQTALKTNHEHLPEEKESYIKLVVEVHPNLQGSVETEEDSTTTESEDEEILVKDTKYLQTYNCESPAPQIDGSLEEKPLQRETPSKNNLDQEPSFGEDLVDNTSVDKVIERGTLNDVNEAMKGNKEDRTVGQTSDEHIHEEDPRVRIQNNEVTLDLSANLEGKAENVPETAVTTMEDVALQVELTENHTIHENGISNEDYSAIQEEAVTEKEDHVGEVNKLNAKCLQASSGILILEGIEEAVSTQTAPVTETASNLDANTAEVNTLVLKAIEMDAVQCQETDSQIIIATQQLDAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry