AibGenesis™ Mouse Anti-sox7 Antibody (CBMOAB-06974FYB)


Cat: CBMOAB-06974FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-06974FYB Monoclonal Zebrafish (Danio rerio), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rhesus (Macaca mulatta) WB, ELISA MO06974FYB 100 µg
CBMOAB-58798FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58798FYA 100 µg
MO-AB-01664R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01664R 100 µg
MO-AB-33842H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33842C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Rhesus (Macaca mulatta)
CloneMO06974FYB
SpecificityThis antibody binds to Zebrafish sox7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The protein may play a role in tumorigenesis. A similar protein in mice is involved in the regulation of the wingless-type MMTV integration site family (Wnt) pathway. (From NCBI)
Product OverviewMouse Anti-Zebrafish sox7 Antibody is a mouse antibody against sox7. It can be used for sox7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSRY-box 7; SRY-box containing gene 7; sox7; SOX
UniProt IDQ6TEN5
Protein RefseqThe length of the protein is 390 amino acids long.
The sequence is show below: MAALISAYSSWPESFECSAGNADVPDGHTSHRAPADKVSEPRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTPPQKRPYVEEAERLRVQHMQDYPNYKYRPRRKKQLKRICKRVDPGFLLTTLGPDQNSLPDPRGCCHPLDKDDESGVSGGFGSPGAALPGVRVFRDPASSNSSFDTYPYGLPTPPEMSPLDAVDHEHQSYYSSSSSVSTSSCSSSNSCPEDRRPTPAHMSSPPPYHPDYSQQAALHSHLGHIPMSHQASGATLIAGPPLSYYSPSFPQVHIHHQGHLGQLSPPPEQGHLEGLDQLSQAELLGEVDRDEFDQYLNSTSYHPEQGGMTVTGHIQVTPASVCSSSATETSLISVLADATAAYYNNYSIS.
For Research Use Only | Not For Clinical Use.
Online Inquiry