AibGenesis™ Mouse Anti-sp9 Antibody (CBMOAB-07016FYB)


Cat: CBMOAB-07016FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07016FYB Monoclonal Zebrafish (Danio rerio), Rhesus (Macaca mulatta) WB, ELISA MO07016FYB 100 µg
CBMOAB-58819FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58819FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rhesus (Macaca mulatta)
CloneMO07016FYB
SpecificityThis antibody binds to Zebrafish sp9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish sp9 Antibody is a mouse antibody against sp9. It can be used for sp9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription factor Sp9; sp9; NP_998125.
UniProt IDQ6NW96
Protein RefseqThe length of the protein is 439 amino acids long.
The sequence is show below: MATSILGEEPRFGTTPLAMLAATCNKIGNTSPLTTLPDSSAFSKGGFHPWKRSSSSCNLGSSLPGFTVATSRSTSGLTTTTGAGNSAFCLASTSPTSSAFSAEYSSLFSNTTSVSSQDSGQSAFISKVHSSADTLYPRVGMAHPYESWYKSGFHSTISGDVANGASTWWDVHTNPGSWLEVQNPAGTLQSSLHSGTPQAIHSQLSGYNPDFSSLTHSAFSSTGISPTASHLLSTSQHLLTQEGFKTVIPTYTDASATNAMISGASSGIGTSSRSSRRYSGRATCDCPNCQEAERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHIKTHTAGGGGKKGSDSDTDTSNLETPRSESPELILEGVNPRVTVKDQSPHHES.
For Research Use Only | Not For Clinical Use.
Online Inquiry