AibGenesis™ Mouse Anti-SPACA4 Antibody (MO-AB-20758R)


Cat: MO-AB-20758R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20758R Monoclonal Cattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO20758R 100 µg
MO-AB-29121H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29121C 100 µg
MO-AB-30360R Monoclonal Pig (Sus scrofa) WB, ELISA MO30360R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO20758R
SpecificityThis antibody binds to Cattle SPACA4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against SPACA4. It can be used for SPACA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSperm acrosome membrane-associated protein 4; SPACA4
UniProt IDQ32PB3
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MVLGWLPLLVMVLAPGTTGVKDCVFCELTDSTSCPGTSMRCGDDEDCFTGHGVAPGVGPIINKGCVHATSCGHEEPINYMGVTYSLTTNCCTGHMCNGAPDPTRGRLAGAAASLALGVLLLLQHVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry