AibGenesis™ Mouse Anti-SPAG11 Antibody (MO-AB-20762R)


Cat: MO-AB-20762R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20762R Monoclonal Cattle (Bos taurus), Dog (Canis lupus familiaris), Rat (Rattus norvegicus) WB, ELISA MO20762R 100 µg
MO-AB-29128H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29128C 100 µg
MO-AB-33493W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33493W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Dog (Canis lupus familiaris), Rat (Rattus norvegicus)
CloneMO20762R
SpecificityThis antibody binds to Cattle SPAG11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against SPAG11. It can be used for SPAG11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSperm associated antigen 11 isoform C; SPAG11; SPAG11B
UniProt IDA4UAF0
Protein RefseqThe length of the protein is 138 amino acids long.
The sequence is show below: MKQFLAPSTLLFVVLLFPGLSRVTHANRQDPKGPRKQEESLGRGTNRSHPLHHQVKRYLVPRKPPFPDTDPGFKVVRCIKGDGKCQKFCNYMEFQLGYCSKKKDACCLPLNRGVDMEAKTLSAASWAIHPNAGVLDKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry