AibGenesis™ Mouse Anti-SPAG16 Antibody (MO-AB-06207W)


Cat: MO-AB-06207W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-06207W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO06207W 100 µg
MO-AB-10979W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10979W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO06207W
SpecificityThis antibody binds to Rhesus SPAG16.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SPAG16 Antibody is a mouse antibody against SPAG16. It can be used for SPAG16 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSperm-associated antigen 16 protein isoform 1; SPAG16
UniProt IDH9EZ05
Protein RefseqThe length of the protein is 269 amino acids long.
The sequence is show below: MAAQRGTPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKPAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLASLERDKVVGQISGLQEILKNVEIGR.
For Research Use Only | Not For Clinical Use.
Online Inquiry