AibGenesis™ Mouse Anti-spag7 Antibody (CBMOAB-07027FYB)


Cat: CBMOAB-07027FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07027FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO07027FYB 100 µg
CBMOAB-58836FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58836FYA 100 µg
MO-AB-06210W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06210W 100 µg
MO-AB-11438W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11438W 100 µg
MO-AB-20768R Monoclonal Cattle (Bos taurus) WB, ELISA MO20768R 100 µg
MO-AB-29133H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29133C 100 µg
MO-AB-35749W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35749W 100 µg
MO-AB-65152W Monoclonal Marmoset WB, ELISA MO65152W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO07027FYB
SpecificityThis antibody binds to Zebrafish spag7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish spag7 Antibody is a mouse antibody against spag7. It can be used for spag7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSperm-associated antigen 7 homolog; spag
UniProt IDQ7SYJ9
Protein RefseqThe length of the protein is 230 amino acids long.
The sequence is show below: MADLLGSILSSMEKPPTVHDQESRRKAREQAARLKKLEEDERRKKAEFRKKMEKEVSEFIKDSTLQKKKYNPMGKIERSILHDVAEVAGLTSFSFGEDEESRYVMLFKKEFAPSDEELEAYRKGEEWDPQKAEERRRLKEKAALEEEAASHTQKRPASPNSNYRDKYSHLIGTSAAKDAAHTLQANRAYGCVPVANKRDTRSIEEAMNEIRAKKRQKKGDEEAAGSGSSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry