AibGenesis™ Mouse Anti-SPATA7 Antibody (CBMOAB-58884FYA)


Cat: CBMOAB-58884FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58884FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) WB, ELISA MO58884FYA 100 µg
MO-AB-06217W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06217W 100 µg
MO-AB-14896W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14896W 100 µg
MO-AB-30383R Monoclonal Pig (Sus scrofa) WB, ELISA MO30383R 100 µg
MO-AB-65180W Monoclonal Marmoset WB, ELISA MO65180W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa)
CloneMO58884FYA
SpecificityThis antibody binds to Rhesus SPATA7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SPATA7 Antibody is a mouse antibody against SPATA7. It can be used for SPATA7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSPATA7
UniProt IDF7HIE5
Protein RefseqThe length of the protein is 599 amino acids long.
The sequence is show below: MDGSRRVRATSVLPRYGPPCLFKGHLSTKSNAFCTDSSSLRLSTLQLVKNHMAVHYNKILSAKAAVDCSVPVSMSTSVKYADQQRREKLKKELARCEKEFKLTKTAMRANSKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSDKVITNGPEKNSSSSPSSVDYAASGPRKPGSGTLYGRRPRSTFPNSHRFQLVISKAPSGDLLDKHAELFSNKQLPFTPRTLKTEAKSFLSQYRYYTPAKRKKDFADQRIEAETQTELSFKSELGTAETKNVTESEMNIKQASNCVTYDAKEKIAPLPLQGHDLTWDEIKDDALQHSSPRAVCQYSLKPPATSKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNLFDFKKAGNSEPNELKHESEVTIQQERQEYQKALNMLSSAPKDENEIFSSPTEFFLPLYKSKHSEGVIIQQVNDETNLEPSTLDENNPSISDSLTDQETSVNVIEGDSDPEKVEISNGSCSPNTSLSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV.
For Research Use Only | Not For Clinical Use.
Online Inquiry