AibGenesis™ Mouse Anti-SPINLW1 Antibody (CBMOAB-58942FYA)


Cat: CBMOAB-58942FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-58942FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO58942FYA 100 µg
MO-AB-20827R Monoclonal Cattle (Bos taurus) WB, ELISA MO20827R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO58942FYA
SpecificityThis antibody binds to Rhesus SPINLW1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SPINLW1 Antibody is a mouse antibody against SPINLW1. It can be used for SPINLW1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesEppin; SPINLW1
UniProt IDF7HTA6
Protein RefseqThe length of the protein is 133 amino acids long.
The sequence is show below: MGSSGLLSLLVLFILLVNVQGPGLTDWLFPRRCPTIREECEFRERDVCTRHRQCPDNKKCCVFSCGKKCLDLKQDVCEMPNETGPCLAFFIRWWYDKKNNTCSTFVYGGCQGNNNNFQSEANCLNTCKNKRFP.
For Research Use Only | Not For Clinical Use.
Online Inquiry