AibGenesis™ Mouse Anti-spsb1 Antibody (CBMOAB-07238FYB)


Cat: CBMOAB-07238FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07238FYB Monoclonal Zebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta) WB, ELISA MO07238FYB 100 µg
CBMOAB-10166HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO10166HB 100 µg
CBMOAB-58996FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO58996FYA 100 µg
MO-AB-07991H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07991C 100 µg
MO-AB-18164W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18164W 100 µg
MO-AB-20860R Monoclonal Cattle (Bos taurus) WB, ELISA MO20860R 100 µg
MO-AB-30416R Monoclonal Pig (Sus scrofa) WB, ELISA MO30416R 100 µg
MO-AB-65262W Monoclonal Marmoset WB, ELISA MO65262W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rhesus (Macaca mulatta)
CloneMO07238FYB
SpecificityThis antibody binds to Zebrafish spsb1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish spsb1 Antibody is a mouse antibody against spsb1. It can be used for spsb1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSplA/ryanodine receptor domain and SOCS box containing 1; spsb
UniProt IDQ4V8W1
Protein RefseqThe length of the protein is 273 amino acids long.
The sequence is show below: MGQKVPGGIKTVDMRDPAFRPLKLELQALDYTKPSRLDMLLDMPSASQDIQVQHSWNNDDRSLNIFVKEDNKLIFHRHPVAQSTDAIRGRVGYTRGLHVWEISWAMRQRGTHAVVGVATGEAPLHSVGYTALVGNNSESWGWDLGRNKLYHDGKNQPSRTYPAFLEPDETFIVPDSFLVVLDMDEGTLSFIVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEIRIRYINGLDPEPLPLMDLCRRSVRVALGRERLSEIHGLPLPASLKNYLLYQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry