AibGenesis™ Mouse Anti-spx Antibody (CBMOAB-07270FYB)


Cat: CBMOAB-07270FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07270FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus), Silkworm (Bombyx mori) WB, ELISA MO07270FYB 100 µg
CBMOAB-31818FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO31818FYA 100 µg
MO-AB-19109W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19109W 100 µg
MO-AB-20869R Monoclonal Cattle (Bos taurus) WB, ELISA MO20869R 100 µg
MO-AB-29187H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29187C 100 µg
MO-AB-70440W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70440W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Rat (Rattus norvegicus), Silkworm (Bombyx mori)
CloneMO07270FYB
SpecificityThis antibody binds to Zebrafish spx.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a hormone involved in modulation of cardiovascular and renal function. It has also been shown in rats to cause weight loss. Several transcript variants have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish spx Antibody is a mouse antibody against spx. It can be used for spx detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSpexin; Spexin hormone; [Cleaved into: Spexin-1]; spx; si:dkey-13i19.
UniProt IDF1QQI2
Protein RefseqThe length of the protein is 102 amino acids long.
The sequence is show below: MKDLRTLAAYALALLLLATFVSHSWSAPKGSFQRRNWTPQAMLYLKGTQGRRFVSEDRNEGDLYDTIRLESRSQNTENLSISKAAAFLLNILQQARDEDEPY.
For Research Use Only | Not For Clinical Use.
Online Inquiry