AibGenesis™ Mouse Anti-SPX2 Antibody (CBMOAB-07271FYB)
Cat: CBMOAB-07271FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-07271FYB | Monoclonal | Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), French-bean, Medaka (Oryzias latipes), Rice, Rice (Oryza) | WB, ELISA | MO07271FYB | 100 µg | ||
| CBMOAB-41722FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO41722FC | 100 µg | ||
| CBMOAB-89520FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89520FYB | 100 µg | ||
| MO-AB-01681R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01681R | 100 µg | ||
| MO-AB-36616W | Monoclonal | French-bean | WB, ELISA | MO36616W | 100 µg | ||
| MO-MMB-0484 | Polyclonal | Rice | ELISA, WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), A. thaliana (Arabidopsis thaliana), French-bean, Medaka (Oryzias latipes), Rice, Rice (Oryza) |
| Clone | MO07271FYB |
| Specificity | This antibody binds to Zebrafish SPX2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish SPX2 Antibody is a mouse antibody against SPX2. It can be used for SPX2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Spexin 2; SPX |
| UniProt ID | A0A077DF94 |
| Protein Refseq | The length of the protein is 70 amino acids long. The sequence is show below: MISRVWILWTLVLFLLVTESHCIQKSSLSKNWGPQSMLYLKGKHGRRFVPDIDDHFISNSGLKSWYAVFK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry