AibGenesis™ Mouse Anti-SRP14 Antibody (CBMOAB-04213CR)


Cat: CBMOAB-04213CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-04213CR Monoclonal Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Malaria parasite, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO04213CR 100 µg
CBMOAB-07330FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO07330FYB 100 µg
CBMOAB-31974FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO31974FYA 100 µg
CBMOAB-41779FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO41779FC 100 µg
CBMOAB-59069FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59069FYA 100 µg
CBMOAB-89528FYB Monoclonal Rice (Oryza) WB, ELISA MO89528FYB 100 µg
MO-AB-08009H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08009C 100 µg
MO-AB-17103H Monoclonal Malaria parasite WB, ELISA MO17103C 100 µg
MO-AB-17789Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17789Y 100 µg
MO-AB-20892R Monoclonal Cattle (Bos taurus) WB, ELISA MO20892R 100 µg
MO-AB-26142W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26142W 100 µg
MO-AB-29197H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29197C 100 µg
MO-AB-33517W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33517W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityYeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Malaria parasite, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO04213CR
SpecificityThis antibody binds to Yeast SRP14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSignal-recognition-particle (SRP) assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum (ER) membrane. SRP is required for the cotranslational protein translocation for ER import and preferentially recognizes strongly hydrophobic signal sequences. It is involved in targeting the nascent chain-ribosome (RNC) complex to the ER and is proposed to participate in the arrest of nascent chain elongation during membrane targeting. SRP14 binds scR1 RNA to form the probable Alu domain of SRP responsible for elongation arrest. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Yeast SRP14 Antibody is a mouse antibody against SRP14. It can be used for SRP14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSignal recognition particle subunit SRP14; Signal recognition particle 14 kDa protein homolog; SRP14; YDL092W
UniProt IDP38985
Protein RefseqThe length of the protein is 146 amino acids long. The sequence is show below: MANTGCLSPGAFLSKVPEFFQTANEKHITVRLTAKRLIEHDPVEGNLEFDSTNHPDYDVSKKASEISVSSRSDREYPLLIRMSYGSHDKKTKCSTVVKASELDQFWQEYSSVFKGGMQNLIKKKKKKSKNGTISKTGKKNKVAKKN.
For Research Use Only | Not For Clinical Use.
Online Inquiry