AibGenesis™ Mouse Anti-SRP14 Antibody (CBMOAB-04213CR)
Cat: CBMOAB-04213CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-04213CR | Monoclonal | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Malaria parasite, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO04213CR | 100 µg | ||
| CBMOAB-07330FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO07330FYB | 100 µg | ||
| CBMOAB-31974FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO31974FYA | 100 µg | ||
| CBMOAB-41779FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO41779FC | 100 µg | ||
| CBMOAB-59069FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO59069FYA | 100 µg | ||
| CBMOAB-89528FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89528FYB | 100 µg | ||
| MO-AB-08009H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO08009C | 100 µg | ||
| MO-AB-17103H | Monoclonal | Malaria parasite | WB, ELISA | MO17103C | 100 µg | ||
| MO-AB-17789Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17789Y | 100 µg | ||
| MO-AB-20892R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20892R | 100 µg | ||
| MO-AB-26142W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26142W | 100 µg | ||
| MO-AB-29197H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29197C | 100 µg | ||
| MO-AB-33517W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33517W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Malaria parasite, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Rice (Oryza), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO04213CR |
| Specificity | This antibody binds to Yeast SRP14. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Signal-recognition-particle (SRP) assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum (ER) membrane. SRP is required for the cotranslational protein translocation for ER import and preferentially recognizes strongly hydrophobic signal sequences. It is involved in targeting the nascent chain-ribosome (RNC) complex to the ER and is proposed to participate in the arrest of nascent chain elongation during membrane targeting. SRP14 binds scR1 RNA to form the probable Alu domain of SRP responsible for elongation arrest. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast SRP14 Antibody is a mouse antibody against SRP14. It can be used for SRP14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Signal recognition particle subunit SRP14; Signal recognition particle 14 kDa protein homolog; SRP14; YDL092W |
| UniProt ID | P38985 |
| Protein Refseq | The length of the protein is 146 amino acids long. The sequence is show below: MANTGCLSPGAFLSKVPEFFQTANEKHITVRLTAKRLIEHDPVEGNLEFDSTNHPDYDVSKKASEISVSSRSDREYPLLIRMSYGSHDKKTKCSTVVKASELDQFWQEYSSVFKGGMQNLIKKKKKKSKNGTISKTGKKNKVAKKN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry