AibGenesis™ Mouse Anti-SRSF8 Antibody (CBMOAB-59109FYA)
Cat: CBMOAB-59109FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-59109FYA | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) | WB, ELISA | MO59109FYA | 100 µg | ||
| MO-AB-23306W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23306W | 100 µg | ||
| MO-AB-29208H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29208C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) |
| Clone | MO59109FYA |
| Specificity | This antibody binds to Rhesus SRSF8. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of a family of proteins containing a ribonucleoprotein (RNP)-type RNA binding motif and a carboxyl-terminal arginine-serine-rich (RS) domain. The encoded protein functions as a pre-mRNA splicing factor. There is a pseudogene for this gene on chromosome 7. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus SRSF8 Antibody is a mouse antibody against SRSF8. It can be used for SRSF8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Serine/arginine-rich splicing factor 8; SRSF8 |
| UniProt ID | H9EYZ5 |
| Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: MSCGRPPPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREHHTKAPRGFAFVRFHNRRDAEDAEDAMDGAELDGRELR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry