AibGenesis™ Mouse Anti-SSBP3 Antibody (CBMOAB-59119FYA)


Cat: CBMOAB-59119FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59119FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus), Marmoset WB, ELISA MO59119FYA 100 µg
MO-AB-08038H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08038C 100 µg
MO-AB-19550W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19550W 100 µg
MO-AB-20935R Monoclonal Cattle (Bos taurus) WB, ELISA MO20935R 100 µg
MO-AB-65393W Monoclonal Marmoset WB, ELISA MO65393W 100 µg
MO-DKB-01580W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Bovine (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus), Marmoset
CloneMO59119FYA
SpecificityThis antibody binds to Rhesus SSBP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SSBP3 Antibody is a mouse antibody against SSBP3. It can be used for SSBP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSSBP3
UniProt IDF7HMU8
Protein RefseqThe length of the protein is 368 amino acids long.
The sequence is show below: MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNPSSMMGPHSQPPGGVPGTQPLLPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMGPGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINPVPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV.
For Research Use Only | Not For Clinical Use.
Online Inquiry