AibGenesis™ Mouse Anti-st6galnac3 Antibody (CBMOAB-07612FYB)


Cat: CBMOAB-07612FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-07612FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO07612FYB 100 µg
MO-AB-11290W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11290W 100 µg
MO-AB-29236H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29236C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO07612FYB
SpecificityThis antibody binds to Zebrafish st6galnac3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish st6galnac3 Antibody is a mouse antibody against st6galnac3. It can be used for st6galnac3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-2,6-sialyltransferase; Beta-galactosamide alpha-2,6-sialyltransferase; ST6 (Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1, 3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3; st6galnac3; siat7c st6GalNAc II
UniProt IDQ704S4
Protein RefseqThe length of the protein is 306 amino acids long.
The sequence is show below: MAWIWKKKSVIVTSLIVVVSLFLVVINCSEKPYFLLQPVFGQSFSRNWMFSRPPHKASKPHHGYLSVPNQEPLKLHCEVCSVVSSSGQILGREAGADIDQSSCIWRMNNAPTRGFERDVGHRTDLRVVSHTSVPLLIQKPQHFFGQGNETVYVVWGPLRNMRQDGKGIVYNMLRQAVENYPQARIYVTTEERMNYCDTVFKKETGKDRIQSGSYLSTGWFTLILAMDMCKEIRVYGMINDTYCKSEGYKKVPYHYYEAGSRDECAEYLLHESAPYGGHRFITEKAVFAKWAKTHPIKFFSPEWQLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry