AibGenesis™ Mouse Anti-stard4 Antibody (MO-AB-08080H)


Cat: MO-AB-08080H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-08080H Monoclonal Frog (Xenopus laevis), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO08080C 100 µg
MO-AB-16050W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16050W 100 µg
MO-AB-29240H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29240C 100 µg
MO-AB-30476R Monoclonal Pig (Sus scrofa) WB, ELISA MO30476R 100 µg
MO-AB-65468W Monoclonal Marmoset WB, ELISA MO65468W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO08080C
SpecificityThis antibody binds to Frog stard4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against stard4. It can be used for stard4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC100036965 protein; stard4; LOC100036965
UniProt IDA1L2V5
Protein RefseqThe length of the protein is 206 amino acids long.
The sequence is show below: MDDLDIPSKTTKLQNTLIQYHCTLEEEWRVAKKSSDVTAWRKPSEEFGGCLYKIEGIVEDDYNRIVDYIRPGPYRLQWDSLMTSMDIIKEFNKECCVMRYTTAGQLLNIISPREFVDFSYTTQYEDGLLTCGVGIEYEDARPNCVRGFNHPCGWFCVPLQNNPQHSLLTGYIQTDLRGMLLQKTVDFAMASSLVNFYSDLKKALKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry