AibGenesis™ Mouse Anti-STF2 Antibody (CBMOAB-04282CR)
Cat: CBMOAB-04282CR

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast, Soybean (Glycine max) |
| Clone | MO04282CR |
| Specificity | This antibody binds to Yeast STF2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Found to stabilize, together with STF1, a complex of intrinsic ATPase inhibitor INH1 and proton-translocating ATPase (F1F0-ATPase) in mitochondrial membranes, also acts as a hydrophilins that enhances dry stress tolerance. Cell viability after desiccation and rehydration is due to the antioxidant capacity of the protein, which reduces the number of apoptotic cells during stress conditions by minimising the accumulation of reactive oxygen species (ROS) in the cells. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Yeast STF2 Antibody is a mouse antibody against STF2. It can be used for STF2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ATPase-stabilizing factor 15 kDa protein; STF2; YGR008C |
| UniProt ID | P16965 |
| Protein Refseq | The length of the protein is 84 amino acids long. The sequence is show below: MTRTNKWTEREGKADPKYFSHTGNYGESPNHIKKQGSGKGNWGKPGDEIDDLIDNGEIPPVFKKDRRGSNLQSHEQKFENVQKE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry