AibGenesis™ Mouse Anti-STX10 Antibody (CBMOAB-59358FYA)


Cat: CBMOAB-59358FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59358FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset WB, ELISA MO59358FYA 100 µg
MO-AB-08137H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08137C 100 µg
MO-AB-65577W Monoclonal Marmoset WB, ELISA MO65577W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Marmoset
CloneMO59358FYA
SpecificityThis antibody binds to Rhesus STX10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Golgi apparatus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus STX10 Antibody is a mouse antibody against STX10. It can be used for STX10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSTX10
UniProt IDF6YXW4
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIDILGLLEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAPQKSLSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSG.
For Research Use Only | Not For Clinical Use.
Online Inquiry