Mouse Anti-Sugar beet rps15 Antibody (MO-AB-30527H)
Cat: MO-AB-30527H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sugar beet (Beta vulgaris) |
Clone | MO30527C |
Specificity | This antibody binds to Sugar beet rps15. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Chloroplast; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S19P family of ribosomal proteins. It is located in the cytoplasm. This gene has been found to be activated in various tumors, such as insulinomas, esophageal cancers, and colon cancers. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternative splicing results in multiple transcript variants. |
Product Overview | This product is a mouse antibody against rps15. It can be used for rps15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 30S ribosomal protein S15; rps15 |
UniProt ID | A0A023ZQA9 |
Protein Refseq | The length of the protein is 90 amino acids long. The sequence is show below: MKKNSFISVISDEKKEENRGSVEFQVFCFTNKIRRLTSHLELHKKDYSSQRGLRKILGKRQRLLAYLSKKNVVRYKELISQLNIRELKTR. |
See other products for " Rps15 "
MO-AB-28653H | Mouse Anti-Rat Rps15 Antibody (MO-AB-28653H) |
MO-AB-63564W | Mouse Anti-Marmoset RPS15 Antibody (MO-AB-63564W) |
CBMOAB-56818FYA | Mouse Anti-Rhesus RPS15 Antibody (CBMOAB-56818FYA) |
CBMOAB-30099FYA | Mouse Anti-D. melanogaster Rps15 Antibody (CBMOAB-30099FYA) |
MO-AB-00003H | Mouse Anti-Arabidopsis rps15 Antibody (MO-AB-00003H) |
MO-AB-39483W | Mouse Anti-Grape rps15 Antibody (MO-AB-39483W) |
MO-AB-11887W | Mouse Anti-Chimpanzee RPS15 Antibody (MO-AB-11887W) |
MO-AB-17510Y | Mouse Anti-Sheep RPS15 Antibody (MO-AB-17510Y) |
CBMOAB-03597CR | Mouse Anti-Yeast RPS15 Antibody (CBMOAB-03597CR) |
MO-AB-49497W | Mouse Anti-Maize rps15 Antibody (MO-AB-49497W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry