Mouse Anti-Yeast RPS15 Antibody (CBMOAB-03597CR)
Cat: CBMOAB-03597CR
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Yeast |
| Clone | MO03597CR |
| Specificity | This antibody binds to Yeast RPS15. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel (PubMed:22096102). uS19 is involved in the nuclear export of the small ribosomal subunit precursor. Has a role in the late stage of the assembly of pre-40S particles within the nucleus and controls their export to the cytoplasm (PubMed:15167894). |
| Product Overview | Mouse Anti-Yeast RPS15 Antibody is a mouse antibody against RPS15. It can be used for RPS15 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 40S ribosomal protein S15; RIG protein; RP52; S21; YS21; RPS15; RPS21; YOL040C |
| UniProt ID | Q01855 |
| Protein Refseq | The length of the protein is 142 amino acids long. The sequence is show below: MSQAVNAKKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFMKKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRFIPLK. |
See other products for " Rps15 "
| CBMOAB-30099FYA | Mouse Anti-D. melanogaster Rps15 Antibody (CBMOAB-30099FYA) |
| CBMOAB-40641FYC | Mouse Anti-Arabidopsis RPS15 Antibody (CBMOAB-40641FYC) |
| MO-AB-17510Y | Mouse Anti-Sheep RPS15 Antibody (MO-AB-17510Y) |
| CBMOAB-56818FYA | Mouse Anti-Rhesus RPS15 Antibody (CBMOAB-56818FYA) |
| MO-AB-00562W | Mouse Anti-Barrel medic rps15 Antibody (MO-AB-00562W) |
| MO-AB-30527H | Mouse Anti-Sugar beet rps15 Antibody (MO-AB-30527H) |
| MO-AB-49497W | Mouse Anti-Maize rps15 Antibody (MO-AB-49497W) |
| MO-AB-28653H | Mouse Anti-Rat Rps15 Antibody (MO-AB-28653H) |
| CBMOAB-09361HCB | Mouse Anti-C. elegans RPS15 Antibody (CBMOAB-09361HCB) |
| CBMOAB-89220FYB | Mouse Anti-Rice RPS15 Antibody (CBMOAB-89220FYB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry