AibGenesis™ Mouse Anti-SYNGR1 Antibody (CBMOAB-59571FYA)


Cat: CBMOAB-59571FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59571FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Frog (Xenopus laevis), Marmoset, Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus) WB, ELISA MO59571FYA 100 µg
MO-AB-01486L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01486L 100 µg
MO-AB-04199Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04199Y 100 µg
MO-AB-08218H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08218C 100 µg
MO-AB-16025W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16025W 100 µg
MO-AB-21185R Monoclonal Cattle (Bos taurus) WB, ELISA MO21185R 100 µg
MO-AB-29312H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29312C 100 µg
MO-AB-33870H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33870C 100 µg
MO-AB-65720W Monoclonal Marmoset WB, ELISA MO65720W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Frog (Xenopus laevis), Marmoset, Nile tilapia (Oreochromis niloticus), Rat (Rattus norvegicus)
CloneMO59571FYA
SpecificityThis antibody binds to Rhesus SYNGR1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SYNGR1 Antibody is a mouse antibody against SYNGR1. It can be used for SYNGR1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSYNGR1
UniProt IDF7HB19
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: MLTLEFGILEFDPSWVGNWTQRSWVSWRSRPGCRLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP.
For Research Use Only | Not For Clinical Use.
Online Inquiry