AibGenesis™ Mouse Anti-SYNGR4 Antibody (CBMOAB-59576FYA)
Cat: CBMOAB-59576FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-59576FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO59576FYA | 100 µg | ||
| MO-AB-01488L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01488L | 100 µg | ||
| MO-AB-08557W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08557W | 100 µg | ||
| MO-AB-21190R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21190R | 100 µg | ||
| MO-AB-29316H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO29316C | 100 µg | ||
| MO-AB-35794W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35794W | 100 µg | ||
| MO-AB-46746W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46746W | 100 µg | ||
| MO-AB-65723W | Monoclonal | Marmoset | WB, ELISA | MO65723W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO59576FYA |
| Specificity | This antibody binds to Rhesus SYNGR4. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus SYNGR4 Antibody is a mouse antibody against SYNGR4. It can be used for SYNGR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Synaptogyrin-4; SYNGR4 |
| UniProt ID | H9FCY8 |
| Protein Refseq | The length of the protein is 78 amino acids long. The sequence is show below: MESPQLHCILNSNNVACSFAVVAGFLAFFSCLAFLVLDTQETHIADTRFKTAFQLLDLILAVLWAVVWFVGFCFLANQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry