AibGenesis™ Mouse Anti-SYPL2 Antibody (CBMOAB-59593FYA)


Cat: CBMOAB-59593FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59593FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO59593FYA 100 µg
MO-AB-08224H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08224C 100 µg
MO-AB-10153Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10153Y 100 µg
MO-AB-21200R Monoclonal Cattle (Bos taurus) WB, ELISA MO21200R 100 µg
MO-AB-65738W Monoclonal Marmoset WB, ELISA MO65738W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO59593FYA
SpecificityThis antibody binds to Rhesus SYPL2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SYPL2 Antibody is a mouse antibody against SYPL2. It can be used for SYPL2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSYPL2
UniProt IDF6VLE0
Protein RefseqThe length of the protein is 270 amino acids long.
The sequence is show below: MSSTESAGRTADKSPRQQVDRLLVGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGETGAMVRCNNEAKDVSSIIVAFGYPFRLHRIQYEMPLCDEESSSKTMHLMGDFSAPAEFFVTLGIFSFFYTMAALVIYLRFHNLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKGATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANISVLFGFINFFLWAGNCWFVFKETPWHGQGQGQGQDQDQGQGPSQESAAEQGAVEKQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry