AibGenesis™ Mouse Anti-Syt14 Antibody (CBMOAB-32463FYA)


Cat: CBMOAB-32463FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-32463FYA Monoclonal Fruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Rhesus (Macaca mulatta) WB, ELISA MO32463FYA 100 µg
CBMOAB-59599FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59599FYA 100 µg
MO-AB-06385W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06385W 100 µg
MO-AB-08228H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08228C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Frog (Xenopus laevis), Rhesus (Macaca mulatta)
CloneMO32463FYA
SpecificityThis antibody binds to fruit fly Syt14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Syt14 Antibody is a mouse antibody against Syt14. It can be used for Syt14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAT15369p; Synaptotagmin 14; Syt14
UniProt IDQ9VN04
Protein RefseqThe length of the protein is 586 amino acids long.
The sequence is show below: MIVTSASGLDSTPTLGTIEVTTLLGAFFGVLVLLLLLFLFISRKCCFHYRHAINCCDERHLAVKCVQKITRKRRYENTSSDSEEDILRRLRWHQQHQLGEKPGGYGLGISQANPLTAQSFNYHQAGASADLQRVTVSRDPLAIAERGKVGIPSSHSECSSNDSMEVSVDSHTGVLTGLSKATTTVPHPATAFRNPCGEHRAKTQALRYQHRVNVAAPPKLDKERDNVLVVPMVNAYSINNNNNSITTSNNHPSSNNNDDEPLFDTSDLRSIKSDDLLVGVDQKEPAVQRGPIELELSLLYDAPMRKMTVHVMQAKNLPPLGSGQTTHTQVRMLMLPSKKQKLKTKIRSGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLELETNLWLPLEPRNTSSGLGSTSDLLSLARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWHVLVDS.
For Research Use Only | Not For Clinical Use.
Online Inquiry