Mouse Anti-TAF13 Antibody (MO-AB-13378Y)


Cat: MO-AB-13378Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13378Y Monoclonal O. mykiss (Oncorhynchus mykiss), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio) WB, ELISA MO13378Y 100 µg
CBMOAB-32535FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO32535FYA 100 µg
CBMOAB-08045FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO08045FYB 100 µg
CBMOAB-04373CR Monoclonal Yeast WB, ELISA MO04373CR 100 µg
CBMOAB-11876HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO11876HB 100 µg
MO-AB-06404W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06404W 100 µg
MO-AB-11358W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11358W 100 µg
MO-AB-46751W Monoclonal Horse (Equus caballus) WB, ELISA MO46751W 100 µg
MO-AB-65799W Monoclonal Marmoset WB, ELISA MO65799W 100 µg
MO-AB-21231R Monoclonal Cattle (Bos taurus) WB, ELISA MO21231R 100 µg
MO-AB-08241H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08241C 100 µg
MO-AB-29335H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29335C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityO. mykiss (Oncorhynchus mykiss), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Yeast, Zebrafish (Danio rerio)
CloneMO13378Y
SpecificityThis antibody binds to O. mykiss TAF13.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInitiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a small subunit associated with a subset of TFIID complexes. This subunit interacts with TBP and with two other small subunits of TFIID, TAF10 and TAF11. There is a pseudogene located on chromosome 6.
Product OverviewThis product is a mouse antibody against TAF13. It can be used for TAF13 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesOncorhynchus mykiss genomic scaffold, scaffold_589; Transcription initiation factor TFIID subunit 13; TAF13
UniProt IDC1BHP0
Protein RefseqThe length of the protein is 124 amino acids long. The sequence is show below: MAEEEDEAGFDEDLDDGAVGADGNHGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFVTEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS.
See other products for " TAF13 "
For Research Use Only | Not For Clinical Use.
Online Inquiry