AibGenesis™ Mouse Anti-TAFA5 Antibody (MO-AB-13088W)


Cat: MO-AB-13088W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13088W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO13088W 100 µg
MO-AB-21244R Monoclonal Cattle (Bos taurus) WB, ELISA MO21244R 100 µg
MO-AB-29346H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29346C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO13088W
SpecificityThis antibody binds to Chimpanzee TAFA5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee TAFA5 Antibody is a mouse antibody against TAFA5. It can be used for TAFA5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFamily with sequence similarity 19, member A5; Chemokine (C-C motif)-like; FAM19A5
UniProt IDH2QLX1
Protein RefseqThe length of the protein is 132 amino acids long.
The sequence is show below: MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRTIARQTARCACRKGQIAGTTRARPACVDARIIKTKQWCDMLPCLEGEGCDLLINRSGWTCTQPGGRIKTTTVS.
For Research Use Only | Not For Clinical Use.
Online Inquiry