AibGenesis™ Mouse Anti-tas2r38 Antibody (CBMOAB-59752FYA)
Cat: CBMOAB-59752FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-59752FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Marmoset, Sheep (Ovis aries) | WB, ELISA | MO59752FYA | 100 µg | ||
| MO-AB-09658W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09658W | 100 µg | ||
| MO-AB-17861Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17861Y | 100 µg | ||
| MO-AB-20364W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20364W | 100 µg | ||
| MO-AB-21275R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO21275R | 100 µg | ||
| MO-AB-33648W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33648W | 100 µg | ||
| MO-AB-35802W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35802W | 100 µg | ||
| MO-AB-65858W | Monoclonal | Marmoset | WB, ELISA | MO65858W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Marmoset, Sheep (Ovis aries) |
| Clone | MO59752FYA |
| Specificity | This antibody binds to Rhesus tas2r38. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a seven-transmembrane G protein-coupled receptor that controls the ability to taste glucosinolates, a family of bitter-tasting compounds found in plants of the Brassica sp. Synthetic compounds phenylthiocarbamide (PTC) and 6-n-propylthiouracil (PROP) have been identified as ligands for this receptor and have been used to test the genetic diversity of this gene. Although several allelic forms of this gene have been identified worldwide, there are two predominant common forms (taster and non-taster) found outside of Africa. These alleles differ at three nucleotide positions resulting in amino acid changes in the protein (A49P, A262V, and V296I) with the amino acid combination PAV identifying the taster variant (and AVI identifying the non-taster variant). (From NCBI) |
| Product Overview | Mouse Anti-Rhesus tas2r38 Antibody is a mouse antibody against tas2r38. It can be used for tas2r38 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Taste receptor type 2; tas2r38 |
| UniProt ID | F1T2U9 |
| Protein Refseq | The length of the protein is 333 amino acids long. The sequence is show below: MLTLTHICTVSYEVRSTFLFISVLEFAVGFLTNAFISLVNFWDVVKRQPLSNSDCVLLCLSISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAILMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFGRLHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSIPPFLLFLVSSGMLTVSLGRHMRTMKVYTRDSRDPSLEAHIKALKSLISFFCFFVISSCAAFISVPLLILWHDKIGVMVCVGIMAACPSGHAAVLISGNAKLRRAVTTILLWAQSSLKVRADHMADSRILC. |
For Research Use Only | Not For Clinical Use.
Online Inquiry