AibGenesis™ Mouse Anti-TBC1D10C Antibody (CBMOAB-59776FYA)


Cat: CBMOAB-59776FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59776FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Marmoset WB, ELISA MO59776FYA 100 µg
MO-AB-21295R Monoclonal Cattle (Bos taurus) WB, ELISA MO21295R 100 µg
MO-AB-65880W Monoclonal Marmoset WB, ELISA MO65880W 100 µg
MO-DKB-01529W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Marmoset
CloneMO59776FYA
SpecificityThis antibody binds to Rhesus TBC1D10C.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene has an N-terminal Rab-GTPase domain and a binding site at the C-terminus for calcineurin, and is an inhibitor of both the Ras signaling pathway and calcineurin, a phosphatase regulated by calcium and calmodulin. Genes encoding similar proteins are located on chromosomes 16 and 22. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus TBC1D10C Antibody is a mouse antibody against TBC1D10C. It can be used for TBC1D10C detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTBC1D10C
UniProt IDF7CR35
Protein RefseqThe length of the protein is 324 amino acids long.
The sequence is show below: MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEMTLHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRDLHRQFPLHEMFVSPQGHGKGSCRCSRPTPCIDRSRATARRRGLWLLCCSCTCPRRRPSGAWCRSVRSTSPATTGPTWCQGTVPCGADIGAPGAGHCRATRGLPWPPGDTRSPSSHPPRTAAGGGLHVTGAQRGAVRAGPAAGDQGPAGPAARFCAGAPAPATGPPRWGPSHLRGPAAGRGTTRRQA.
For Research Use Only | Not For Clinical Use.
Online Inquiry