AibGenesis™ Mouse Anti-tbc1d20 Antibody (CBMOAB-08716FYB)


Cat: CBMOAB-08716FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08716FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO08716FYB 100 µg
CBMOAB-59791FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59791FYA 100 µg
MO-AB-12688W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12688W 100 µg
MO-AB-21300R Monoclonal Cattle (Bos taurus) WB, ELISA MO21300R 100 µg
MO-AB-65895W Monoclonal Marmoset WB, ELISA MO65895W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO08716FYB
SpecificityThis antibody binds to Zebrafish tbc1d20.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that belongs to a family of GTPase activator proteins of Rab-like small GTPases. The encoded protein and its cognate GTPase, Rab1, bind the nonstructural protein 5A (NS5A) of the hepatitis C virus (HCV) to mediate viral replication. Depletion of this protein inhibits replication of the virus and HCV infection. Mutations in this gene are associated with Warburg micro syndrome 4. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish tbc1d20 Antibody is a mouse antibody against tbc1d20. It can be used for tbc1d20 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTBC1 domain family, member 20; tbc1d2
UniProt IDQ4QRJ8
Protein RefseqThe length of the protein is 397 amino acids long.
The sequence is show below: MNLKRSRSVGASPLNGVGKQDVESRRRKKMSEITQALSCRPVDVTALRRMAISEGGLMTDEIRRLVWPKLLNVSEENIPEELDPVDRENNKDFNQVLLDVQRSLRRFPPGMPDEQREGLQEEPTDIILRVLVKNPQLHYYQGYHDIVVTFLLVLGERLATALVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIERVNPEVFDFMQQAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLHREEEVLDCECDMAMMHHLLSRIPEDLPYETLISRAGDLFVQFPPSELARERSQQTAVSTFKDFELASTQQRPDVVLRQRRKEQQQRTLEAQRGTVAVVQPTARRFMRLAVMGLTVALGAAALAVVNSALEWAPKLDLLFP.
For Research Use Only | Not For Clinical Use.
Online Inquiry