AibGenesis™ Mouse Anti-tbce Antibody (CBMOAB-08764FYB)


Cat: CBMOAB-08764FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08764FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO08764FYB 100 µg
CBMOAB-32625FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO32625FYA 100 µg
CBMOAB-59838FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59838FYA 100 µg
MO-AB-21319R Monoclonal Cattle (Bos taurus) WB, ELISA MO21319R 100 µg
MO-AB-23460W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23460W 100 µg
MO-AB-46770W Monoclonal Horse (Equus caballus) WB, ELISA MO46770W 100 µg
MO-AB-65934W Monoclonal Marmoset WB, ELISA MO65934W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset, Rhesus (Macaca mulatta)
CloneMO08764FYB
SpecificityThis antibody binds to Zebrafish tbce.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCofactor E is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. Two transcript variants encoding the same protein have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish tbce Antibody is a mouse antibody against tbce. It can be used for tbce detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTubulin-specific chaperone E; Tubulin-folding cofactor E; tbce; NP_001035078.
UniProt IDQ5U378
Protein RefseqThe length of the protein is 521 amino acids long.
The sequence is show below: MMLDEAVGRRVCCDGERGTVRYVGPVPPTAGVWLGVEWDHPERGKHDGSHDGVRYFTCRHPTGGSFVRPQKASFGVDYVTALKQRYEVEIEEVTAEEMKISSKTVVMVGFENVKKKQSVKNLTEVGLRRCEVSAPGPENEIRNTTPFVQSLDLSGNLLSSWEVLAAITEQLDSLQELHLSHNRLSISSAPSSLSSAFSHLRVLSINSCALTWTQVLHCAPMWQQVEELYLADNNITELLRPEHVLQALTVLDLSNNQIAQETVLEISHLPRLERLNLSSTSLSEIKFSDVPAGKKTTLFPALKELLLDDNNISEWRVVNELEKLPSLVYLSCRRNPLLHKEKNLETARQIMIARLGQLELLDMRQILSDERRGAELDYCKMFGSAWLRAGGHREAEKNNPNTDFMTEHPRYLTLIQKYGAPDEGELREQKPFALKNQLLTITFLCPEDLERKPIEKKLPGSMIVQKVKGLLHRLLKLPGVELKLTYTCAKMADREIEIDNDLKPLQFYSVEDGDKILVRWS.
For Research Use Only | Not For Clinical Use.
Online Inquiry