AibGenesis™ Mouse Anti-TCERG1L Antibody (CBMOAB-59894FYA)


Cat: CBMOAB-59894FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59894FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59894FYA 100 µg
MO-AB-06461W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06461W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO59894FYA
SpecificityThis antibody binds to Rhesus TCERG1L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TCERG1L Antibody is a mouse antibody against TCERG1L. It can be used for TCERG1L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription elongation regulator 1-like protein; TCERG1L
UniProt IDH9FAL8
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: KREDKGTRTPPPQILLPLEERVTHFRDMLLERGVSAFSTWEKELHKIVFDPRYLLLNSEERKQIFEQFVKTRIKEEYKEKKSKLLLAKEEFKKLLEESKVSPRTTFKEFAEKYGRDQRFRLVQKRKDQEHFFNQFILILKKRDKENRLRLRKMR.
For Research Use Only | Not For Clinical Use.
Online Inquiry