AibGenesis™ Mouse Anti-TCP14 Antibody (CBMOAB-44870FYC)
Cat: CBMOAB-44870FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44870FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Maize (Zea mays), Tomato (Lycopersicon esculentum) | WB, ELISA | MO44870FC | 100 µg | ||
| MO-AB-35389H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO35389C | 100 µg | ||
| MO-AB-49682W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO49682W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Maize (Zea mays), Tomato (Lycopersicon esculentum) |
| Clone | MO44870FC |
| Specificity | This antibody binds to Arabidopsis TCP14. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Transcription factor involved the regulation of plant development. Together with TCP15, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in leaf and floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Involved in the regulation of seed germination. May regulate the activation of embryonic growth potential during seed germination (PubMed:17953649, PubMed:22155632). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). Involved in positive regulation of plant defense. Represses jasmonate (JA) response to promote disease resistance. Regulates the plant immune system by transcriptionally repressing a subset of JA-responsive genes (PubMed:28132837). (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-Arabidopsis TCP14 Antibody is a mouse antibody against TCP14. It can be used for TCP14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Transcription factor TCP14; TCP14; At3g47620 |
| UniProt ID | Q93Z00 |
| Protein Refseq | The length of the protein is 489 amino acids long. The sequence is show below: MQKPTSSILNVIMDGGDSVGGGGGDDHHRHLHHHHRPTFPFQLLGKHDPDDNHQQQPSPSSSSSLFSLHQHQQLSQSQPQSQSQKSQPQTTQKELLQTQEESAVVAAKKPPLKRASTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPSVIAATGTGTIPANFTSLNISLRSSGSSMSLPSHFRSAASTFSPNNIFSPAMLQQQQQQQRGGGVGFHHPHLQGRAPTSSLFPGIDNFTPTTSFLNFHNPTKQEGDQDSEELNSEKKRRIQTTSDLHQQQQQHQHDQIGGYTLQSSNSGSTATAAAAQQIPGNFWMVAAAAAAGGGGGNNNQTGGLMTASIGTGGGGGEPVWTFPSINTAAAALYRSGVSGVPSGAVSSGLHFMNFAAPMAFLTGQQQLATTSNHEINEDSNNNEGGRSDGGGDHHNTQRHHHHQQQHHHNILSGLNQYGRQVSGDSQASGSLGGGDEEDQQD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry