AibGenesis™ Mouse Anti-tctex1d2 Antibody (CBMOAB-08048FYB)


Cat: CBMOAB-08048FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08048FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO08048FYB 100 µg
CBMOAB-59950FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59950FYA 100 µg
MO-AB-14162W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14162W 100 µg
MO-AB-21393R Monoclonal Cattle (Bos taurus) WB, ELISA MO21393R 100 µg
MO-AB-29394H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29394C 100 µg
MO-AB-66009W Monoclonal Marmoset WB, ELISA MO66009W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO08048FYB
SpecificityThis antibody binds to Zebrafish tctex1d2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains. This gene encodes a subunit of the human cytoplasmic dynein-2 complex. Mutations in this gene are associated with short-rib thoracic dysplasia 17 with or without polydactyly. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish tctex1d2 Antibody is a mouse antibody against tctex1d2. It can be used for tctex1d2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLOC553323 protein; tctex1d2; LOC55332
UniProt IDB1PXA9
Protein RefseqThe length of the protein is 301 amino acids long.
The sequence is show below: GGCYDNVGKAVKRKCETTIAHKRNILLMDTGANTYLIRPNYKDKFKAGVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKLKDMGFDRYKFIVQVVIGEQRGEGVKMAARCFWDADTDNYAQEIYMNDSLFCVAAAFGVYYY.
For Research Use Only | Not For Clinical Use.
Online Inquiry