AibGenesis™ Mouse Anti-TCTEX1D4 Antibody (CBMOAB-59951FYA)


Cat: CBMOAB-59951FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59951FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO59951FYA 100 µg
MO-AB-29395H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29395C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO59951FYA
SpecificityThis antibody binds to Rhesus TCTEX1D4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TCTEX1D4 Antibody is a mouse antibody against TCTEX1D4. It can be used for TCTEX1D4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTCTEX1D4
UniProt IDF7HPS6
Protein RefseqThe length of the protein is 221 amino acids long.
The sequence is show below: MASRPLPPGRQEEENAKDYGPKPSPVRPRGRLPSIDEARPAGPGPGPASRRGSMLGVATSFSRRNSLAGPGAGPGGRRPSLGPVPPLGSRVSFSGLPLAPARQVAPSYRTEPVPGERWEAARAQRALEAALSAGLRDACYSSAEAARLVQELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGIHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYCE.
For Research Use Only | Not For Clinical Use.
Online Inquiry