AibGenesis™ Mouse Anti-tctn2 Antibody (CBMOAB-08961FYB)


Cat: CBMOAB-08961FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-08961FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO08961FYB 100 µg
CBMOAB-59952FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59952FYA 100 µg
MO-AB-06480W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO06480W 100 µg
MO-AB-17652W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17652W 100 µg
MO-AB-66014W Monoclonal Marmoset WB, ELISA MO66014W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO08961FYB
SpecificityThis antibody binds to Zebrafish tctn2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a type I membrane protein that belongs to the tectonic family. Studies in mice suggest that this protein may be involved in hedgehog signaling, and essential for ciliogenesis. Mutations in this gene are associated with Meckel syndrome type 8. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish tctn2 Antibody is a mouse antibody against tctn2. It can be used for tctn2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestctn2; si:ch211-89f7.3; TCTN2 Gene(Protein Coding) Tectonic Family Member 2
UniProt IDF1Q7Y4
Protein RefseqThe length of the protein is 709 amino acids long.
The sequence is show below: XRRGFTAFTNAVIMRHFSSFHIGFYFTCIIFTFLNDGTVCNVVFQPAFIQASGPKISSFLVGNVSGISFSLSAVSSSNATGSILPPSCLPVYQPQWNLSYELIGKNAFLVHVSLNRSLQLCGNETSISDCCLELLCVQETLLVSACVDETPKASLIIQTQIYAQIHPSKPPSVNKTVIPNQVFQPLGQCPCDVSPGECDIRCCCDQDCTREVLGLFATQCFLGPYGGSFSPVPEYQCSAQPSENDPDWFPFLCVISPSYNNPFLGLFYHGGTVSPKPSPSFQAPQMTATLPPINYRQGDPIFTKDDKYFTIPQNTGTGQCVENAPVAFLENFEFQCVRRLQFCPSPSDDLRVDVKDGQGGVIAVSVVDDVADNIRLFVSNSPEVTSEPQQCDNVVVSLRYTFYWRENGLTAIAVTRTTANITVPVFFSSVTLTSRYSAVFVNGNETSQSYSGYQVMRPVIGGVLDSETGVVQRTQISLWQPAGDGLCSSAKLRSALFGINSTSGCVVPVRETLRSLLDGLVTATLVSTSGKPDFYNLTDWVNITTSQQNQSQSAEGSKGECSAVPTHLHIHVKSSIMEIVQGVPQMFIQSMQISFIERTWKIECGVGMMDPCLNPELMQNFPVTSSVTFTDLSLYSQPPRSRFSINFTEFDCDRNDVCWPELAFPFTTYYTGEPYSEALAKGLTLVFFFIAASVLGTPWRQIRQAWRNA.
For Research Use Only | Not For Clinical Use.
Online Inquiry