AibGenesis™ Mouse Anti-tfcp2l1 Antibody (CBMOAB-09193FYB)


Cat: CBMOAB-09193FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09193FYB Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO09193FYB 100 µg
CBMOAB-60088FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60088FYA 100 µg
MO-AB-08372H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08372C 100 µg
MO-AB-66080W Monoclonal Marmoset WB, ELISA MO66080W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO09193FYB
SpecificityThis antibody binds to Zebrafish tfcp2l1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish tfcp2l1 Antibody is a mouse antibody against tfcp2l1. It can be used for tfcp2l1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestfcp2l1; TFCP2L1 Gene(Protein Coding) Transcription Factor CP2 Like 1
UniProt IDE7FDU4
Protein RefseqThe length of the protein is 472 amino acids long.
The sequence is show below: MLFWHSHPENYQQHAQNTYIRDALAPFLKHEEEHQAAEIGASPFHYVLCAATSPAVKLHDETLTYLNQGQSYEIRMLNGKLVEYTDVSSKYVKSIVRVVFHDRRLQYTEHQQLEGWRWNRPGDRILDIDIPLSVGIIEPHAHPLQLNTIEFLWDPDKNASVFIQVNCISTEFTPRKHGGEKGVPFRIQIDTFTASAHGEYTEHMCSASCQVKVFKPKGADRKLKTDREKIEKKSLQDKEKYQLSYKTTVLTECSPWPEAPSISSTSNTPSPAYHSAHTSYSFPEENCSPDQHGEPLLPSCSDHLLPSSSTQDTQQWLHRNRFSSFCRLFSGFSGSDLLKMGRDDFIQICGPADGIRLFNAIKGRCIQPRLTVYVSQLQNRIQPHTKAVGDGVVYHALYLEDLTVLELTEKIANLYNVPSQRIHGVYRQGPKGIHVLVSDEMVQNFTEEASFTISTVKDDRNEGYHVVLKCVL.
For Research Use Only | Not For Clinical Use.
Online Inquiry