AibGenesis™ Mouse Anti-tfec Antibody (CBMOAB-09222FYB)


Cat: CBMOAB-09222FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09222FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) WB, ELISA MO09222FYB 100 µg
CBMOAB-60099FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60099FYA 100 µg
MO-AB-10187Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10187Y 100 µg
MO-AB-21473R Monoclonal Cattle (Bos taurus) WB, ELISA MO21473R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta)
CloneMO09222FYB
SpecificityThis antibody binds to Zebrafish tfec.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the micropthalmia (MiT) family of basic helix-loop-helix leucine zipper transcription factors. MiT transcription factors regulate the expression of target genes by binding to E-box recognition sequences as homo- or heterodimers, and play roles in multiple cellular processes including survival, growth and differentiation. The encoded protein is a transcriptional activator of the nonmuscle myosin II heavy chain-A gene, and may also co-regulate target genes in osteoclasts as a heterodimer with micropthalmia-associated transcription factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish tfec Antibody is a mouse antibody against tfec. It can be used for tfec detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestfec; TFEC Gene(Protein Coding) Transcription Factor EC
UniProt IDQ5TZ58
Protein RefseqThe length of the protein is 396 amino acids long.
The sequence is show below: MPHLTDCSFYKMRDGARVANVQSHLENSKYHLNQTQAQQVKQYLALGSKLASQAHPVAHPLPGQALGTVPVMRNGHMPPVSDSSTPGSPVTLLTLANNQDSEFPMDEVIDDLIGLENGFKDGSLDCMEPGIIMQNNVSLNSSMLEVYGADQEHDTRVLAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQHARDLESRQKKLEQANRRLQLRIQELEIQAHAHGLPSMTASMGTVELSSHLLKQQHHQTQATAASQSAQAPQSTQPPIYPQEGVSSPEYTQRTSLPSIVGEQSDGSNNFSDPLSHFTDFFCSTLKEEHQRLDEILMDDPLSPFGTDPLLSAGSPTAASKESSRRSSFSSEETDDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry