AibGenesis™ Mouse Anti-thap9 Antibody (CBMOAB-60155FYA)


Cat: CBMOAB-60155FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60155FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) WB, ELISA MO60155FYA 100 µg
MO-AB-04410Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04410Y 100 µg
MO-AB-07342W Monoclonal Cat (Felis catus) WB, ELISA MO07342W 100 µg
MO-AB-09783W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO09783W 100 µg
MO-AB-10202Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10202Y 100 µg
MO-AB-21527R Monoclonal Cattle (Bos taurus) WB, ELISA MO21527R 100 µg
MO-AB-33712W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33712W 100 µg
MO-AB-46796W Monoclonal Horse (Equus caballus) WB, ELISA MO46796W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus)
CloneMO60155FYA
SpecificityThis antibody binds to Rhesus thap9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus thap9 Antibody is a mouse antibody against thap9. It can be used for thap9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTHAP domain containing 9; thap9
UniProt IDQ59AB6
Protein RefseqThe length of the protein is 233 amino acids long.
The sequence is show below: AQLLRLTIGKLSDIGITVLAVTSDATAHSVQMAKALGIHIDGDDMKCTFQHPSSSSQQIAYFFDSCHLLRLIRNAFQNFQSIQFINGIAHWQHLVELVALEEQELSNMERIPSTLANLKNHVLKVNCAAQLFSESVASALEYLLSLDLPPFQNCIGTIHFLRLINNLFDIFNSRNCYGKGLKGPLLPETYGKINHVLIEAKTIFVTLSDTSNNQIIKGKQKLGFLGFLLNAES.
For Research Use Only | Not For Clinical Use.
Online Inquiry