AibGenesis™ Mouse Anti-THRSP Antibody (CBMOAB-60201FYA)


Cat: CBMOAB-60201FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60201FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Goat (Capra hircus), Mallard (Anas platyrhynchos), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO60201FYA 100 µg
MO-AB-04417Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO04417Y 100 µg
MO-AB-10210Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10210Y 100 µg
MO-AB-21556R Monoclonal Cattle (Bos taurus) WB, ELISA MO21556R 100 µg
MO-AB-23797H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23797C 100 µg
MO-AB-29449H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29449C 100 µg
MO-AB-38280W Monoclonal Goat (Capra hircus) WB, ELISA MO38280W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Goat (Capra hircus), Mallard (Anas platyrhynchos), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO60201FYA
SpecificityThis antibody binds to Rhesus THRSP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is similar to the gene product of S14, a rat gene whose expression is limited to liver and adipose tissue and is controlled by nutritional and hormonal factors. This gene has been shown to be expressed in liver and adipocytes, particularly in lipomatous modules. It is also found to be expressed in lipogenic breast cancers, which suggests a role in controlling tumor lipid metabolism. (From NCBI)
Product OverviewMouse Anti-Rhesus THRSP Antibody is a mouse antibody against THRSP. It can be used for THRSP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTHRSP
UniProt IDF7HK82
Protein RefseqThe length of the protein is 150 amino acids long.
The sequence is show below: MQVLTKRYPKNCLLTVMDRYSAEVHNMEQVVMIPSLLRDVQLSGHEGRAQAEAPDLYTYFTMLKAICVDVEHGLLPREEWQAKVAGGEAEEAENGTAETEEVEDESASGELELEAQFHLHFSSLHHILIHLTKKAQEVTRKYQEMTGQVW.
For Research Use Only | Not For Clinical Use.
Online Inquiry