AibGenesis™ Mouse Anti-TIGD2 Antibody (CBMOAB-60235FYA)


Cat: CBMOAB-60235FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60235FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) WB, ELISA MO60235FYA 100 µg
MO-AB-19803W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19803W 100 µg
MO-AB-30677R Monoclonal Pig (Sus scrofa) WB, ELISA MO30677R 100 µg
MO-AB-66191W Monoclonal Marmoset WB, ELISA MO66191W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa)
CloneMO60235FYA
SpecificityThis antibody binds to Rhesus TIGD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known. (From NCBI)
Product OverviewMouse Anti-Rhesus TIGD2 Antibody is a mouse antibody against TIGD2. It can be used for TIGD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTIGD2
UniProt IDF7DWH9
Protein RefseqThe length of the protein is 378 amino acids long.
The sequence is show below: MLGKRKRVVLTIKDKLDIIKKLEEGISFKKLSVVYGIGESTVRDIKKNKERIINYANSSDPTSGVSKRKSMKSSTYEELDRVMIEWPRAFKGTDLSNLPVTYYSQKGAWIEQSVFRQWFEKYFVPQVQKHLKSKGLLEKAVLLLDFPPAHPNEEMLSSDDGRIIVKYLPPNVTSLIQPMSQGVLATVKRYYRAGLLQKYMDEGIDPKIFWKNLTVLDAIYEVSRAWSMVKSSTITKAWKKLFPGNEENSGMNIDEGAILAANLATVLQNTEECEHVDIETIDQWFDSRSNDSSCQVLADSESAEDQTKAAEQKPSSKSRKTELNPEKHISHKAALEWTENLLDYLEQQDDMLLSDKLVLRKLRTIIRKKQKIQNNKNH.
For Research Use Only | Not For Clinical Use.
Online Inquiry