AibGenesis™ Mouse Anti-timm8b Antibody (CBMOAB-09441FYB)


Cat: CBMOAB-09441FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09441FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO09441FYB 100 µg
CBMOAB-60253FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60253FYA 100 µg
MO-AB-08437H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08437C 100 µg
MO-AB-21596R Monoclonal Cattle (Bos taurus) WB, ELISA MO21596R 100 µg
MO-AB-22653W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22653W 100 µg
MO-AB-29470H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29470C 100 µg
MO-AB-66208W Monoclonal Marmoset WB, ELISA MO66208W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO09441FYB
SpecificityThis antibody binds to Zebrafish timm8b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a well-conserved family of proteins with similarity to yeast Tim mitochondrial import proteins. This gene is encoded by a nuclear gene and is transported into the intermembrane space of the mitochondrion. When formed into complexes, these proteins guide membrane-spanning proteins across the mitochondrial intermembrane space before they are added into the mitochondrial inner membrane. This gene is adjacent to succinate dehydrogenase, subunit D (SDHD), in which mutations have been found in affected members of families with hereditary paraganglioma. (From NCBI)
Product OverviewMouse Anti-Zebrafish timm8b Antibody is a mouse antibody against timm8b. It can be used for timm8b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranslocase of inner mitochondrial membrane 8 homolog B; Yeast; timm8
UniProt IDB3DGI9
Protein RefseqThe length of the protein is 95 amino acids long.
The sequence is show below: MADFHSSFDLPSAGSSEKAEAAELQRMLAVEQQKAQFQAQVHNFTDVCWDKCVDKPSSKLDSRTETCLVSCVERFIDTTLTITNRFTQMVQKGTH.
For Research Use Only | Not For Clinical Use.
Online Inquiry