Mouse Anti-timp-1 Antibody (CBMOAB-59205FYC)


Cat: CBMOAB-59205FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-59205FYC Monoclonal C. elegans (Caenorhabditis elegans), Frog (Xenopus laevis), Goat (Capra hircus) WB, ELISA MO59205FYC 100 µg
MO-AB-38284W Monoclonal Goat (Capra hircus) WB, ELISA MO38284W 100 µg
MO-AB-08438H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08438C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityC. elegans (Caenorhabditis elegans), Frog (Xenopus laevis), Goat (Capra hircus)
CloneMO59205FYC
SpecificityThis antibody binds to C. elegans timp-1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases (MMPs), a group of peptidases involved in degradation of the extracellular matrix. In addition to its inhibitory role against most of the known MMPs, the encoded protein is able to promote cell proliferation in a wide range of cell types, and may also have an anti-apoptotic function. Transcription of this gene is highly inducible in response to many cytokines and hormones. In addition, the expression from some but not all inactive X chromosomes suggests that this gene inactivation is polymorphic in human females. This gene is located within intron 6 of the synapsin I gene and is transcribed in the opposite direction. [provided by RefSeq, Jul 2008]
Product OverviewMouse Anti-C. elegans timp-1 Antibody is a mouse antibody against timp-1. It can be used for timp-1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein K07C11.3; timp-1
UniProt IDQ21267
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: MLAVVFTFLLCLSFPQSFESCSCMEFQSEKDGYCATSWISKVKVVSKETDGLGLMMSYRLEHLKVIKAPENMTLPETMNTATQESACGQTKFKVGKQYIFGGSLANNDSLLITFCDWRVPLKYIDEPKLEMKPTWKKFVDSVGKCPPPPSPLSS.
See other products for " TIMP-1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry