AibGenesis™ Mouse Anti-tiparp Antibody (CBMOAB-09459FYB)


Cat: CBMOAB-09459FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09459FYB Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO09459FYB 100 µg
CBMOAB-60267FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60267FYA 100 µg
MO-AB-16363W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16363W 100 µg
MO-AB-66215W Monoclonal Marmoset WB, ELISA MO66215W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rhesus (Macaca mulatta)
CloneMO09459FYB
SpecificityThis antibody binds to Zebrafish tiparp.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the poly(ADP-ribose) polymerase superfamily. Studies of the mouse ortholog have shown that the encoded protein catalyzes histone poly(ADP-ribosyl)ation and may be involved in T-cell function. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish tiparp Antibody is a mouse antibody against tiparp. It can be used for tiparp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namestiparp; TIPARP Gene(Protein Coding) TCDD Inducible Poly(ADP-Ribose) Polymerase
UniProt IDF8W3Q5
Protein RefseqThe length of the protein is 624 amino acids long.
The sequence is show below: XQQMGLADKIPLVKPCFKKKHAQRKLDTKCLRALEDPILSTLLSSDALVSGDGVFVPRNPPRPQRNICTAAVEKQSRISQVCLKEEDESTDADVAASELAVEQKVTDIQRVSIDANERRFPPQERDEAAPPSDVSGSKLNDIYTAETLQGANCLAIKEGEIFQDKSEEASLDLVFELLTQLQYHTHQGDAVSICVDFLQGVCVYGSDCAQHHTVLPYHWQIRRVDTQIWQSISDDSQEQLERLYCNPDNEHVRLKFLGRVFTLDFSAMRVCDLEFDLVRRLSTPSSSTSTTTPTNTSPTPNCLTVWKYYCRDNFGWREYSEPVVRLIEEASGRGLKEVRFITLQNQYILNIREGFQQNAVFGFRRQIKKRPLFRSSIMLTPYLQTLGGLSSAFLSSLETSGNQPLSPTSSTPSKMYPETWLPMNNCQDFMRVPVSRDDRSYRTVYSLFHKTVSETKFRILKILRVQNPFLWEKYKRKKEYMSRRMTDMDRMLNERHLFHGTSQDVVEGICKHNFDPRVCGKHATMFGQGSYFARKAVYSHNFSKRSPNGVHYMFLAKVLTGKFTVGNPSMRRPPPLNPRDASSDLFDSCVDNWMDPQIFVIFNDDQSYPYFIVQYEEVGSTVAI.
For Research Use Only | Not For Clinical Use.
Online Inquiry