AibGenesis™ Mouse Anti-tm4sf4 Antibody (CBMOAB-09614FYB)


Cat: CBMOAB-09614FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-09614FYB Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO09614FYB 100 µg
CBMOAB-60346FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60346FYA 100 µg
MO-AB-08481H Monoclonal Frog (Xenopus laevis) WB, ELISA MO08481C 100 µg
MO-AB-21704R Monoclonal Cattle (Bos taurus) WB, ELISA MO21704R 100 µg
MO-AB-29496H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29496C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO09614FYB
SpecificityThis antibody binds to Zebrafish tm4sf4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that can regulate cell proliferation. (From NCBI)
Product OverviewMouse Anti-Zebrafish tm4sf4 Antibody is a mouse antibody against tm4sf4. It can be used for tm4sf4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92479; tm4sf4; zgc:9247
UniProt IDQ6DBQ4
Protein RefseqThe length of the protein is 198 amino acids long.
The sequence is show below: MCSGNFAKCLGITLIPLAIICVLCNILLFFPSGKVADQSQDITDEVFYLGGILGSGVLMIFPALVFLGLKNNDCCGCCGNESCGKRFAMFSSILFAAAGAVGAGYSVIVSCVALNHGPKCFLSDGSNNATYPFTDGNYLSNRTMWELCAGPGDIVTWHLTLFSILLITGIVQIGLCAFQVINGLIGTICGDCCGCCKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry