AibGenesis™ Mouse Anti-TMED6 Antibody (CBMOAB-60401FYA)


Cat: CBMOAB-60401FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60401FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO60401FYA 100 µg
MO-AB-21745R Monoclonal Cattle (Bos taurus) WB, ELISA MO21745R 100 µg
MO-AB-29513H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO29513C 100 µg
MO-AB-66325W Monoclonal Marmoset WB, ELISA MO66325W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO60401FYA
SpecificityThis antibody binds to Rhesus TMED6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus TMED6 Antibody is a mouse antibody against TMED6. It can be used for TMED6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTMED6
UniProt IDF6TW60
Protein RefseqThe length of the protein is 240 amino acids long.
The sequence is show below: MSPLLFGAGLVILNLVTSARSQKTEPLSGSGDQPLFRGADRHDFAIMIPPGGTECFWQFAHQTGYFYFSYEVQRTVGMSHDRHVAATAHNPQGFLIDTSQDVRGQINFSTQETGFYQLCLNNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDILDAIEDSTQKVQNNIFHMWRYYNFARMRKMADFFLTHSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRC.
For Research Use Only | Not For Clinical Use.
Online Inquiry